OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IKBKE (NM_014002) Human Mass Spec Standard

Be the first to review this product
SKU
PH312481
IKBKE MS Standard C13 and N15-labeled recombinant protein (NP_054721)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA807632 IKBKE mouse monoclonal antibody, clone OTI3C5 (formerly 3C5) 100 ul
$447.00
LY415533 Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon (IKBKE) (as WB positive control) 100 ug
$665.00

Other products for "IKBKE or NM_014002"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212481
Predicted MW 80.3 kDa
Protein Sequence
Protein Sequence
>RC212481 representing NM_014002
Red=Cloning site Green=Tags(s)

MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLRKLNHQNIVKL
FAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGN
IMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVT
LYHAATGSLPFIPFGGPRRNKEIMYRITTEKPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPI
LANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQ
EYLFEGHLCVLEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSVAGTPEIQELK
AAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKS
RMRPGLGYNEEQIHKLDKVNFSHLDKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAA
CNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDN
NRIIERLNRVPAPPDV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054721
RefSeq Size 3263
RefSeq ORF 2148
Synonyms IKK-E; IKK-i; IKKE; IKKI
Locus ID 9641
UniProt ID Q14164
Cytogenetics 1q32.1
Summary IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines (Hutti et al., 2009 PubMed 19481526).supplied by OMIM, Oct 2009
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IKBKE" proteins (3)
SKU Description Size Price
LC415533 Lyophilized IKBKE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415533 Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon (IKBKE) (as WB positive control) 100 ug
$665.00
TP312481 Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon (IKBKE), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products