OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PAX2 (NM_000278) Human Mass Spec Standard

Be the first to review this product
SKU
PH312112
PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_000269)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY429172 Transient overexpression lysate of paired box 2 (PAX2), transcript variant a (as WB positive control) 100 ug
$436.00

Other products for "PAX2 or NM_000278"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212112
Predicted MW 41.9 kDa
Protein Sequence
Protein Sequence
>RC212112 representing NM_000278
Red=Cloning site Green=Tags(s)

MDMHCKADPFSAMHRHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGR
YYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIRT
KVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGS
VPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVK
SSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSH
PQYTAYNEAWRFSNPALLSSPYYYSAAPRGSAPAAAAAAYDRH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000269
RefSeq Size 4207
RefSeq ORF 1179
Synonyms FSGS7; PAPRS
Locus ID 5076
UniProt ID Q02962
Cytogenetics 10q24.31
Summary PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. provided by RefSeq, Dec 2014
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PAX2" proteins (19)
SKU Description Size Price
PH312051 PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003978) 10 ug
$3,360.00
PH318386 PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003979) 10 ug
$3,360.00
LC400106 Lyophilized PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418300 Lyophilized PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418301 Lyophilized PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418302 Lyophilized PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418303 Lyophilized PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429172 Lyophilized PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400106 Transient overexpression lysate of paired box 2 (PAX2), transcript variant b (as WB positive control) 100 ug
$436.00
LY418300 Transient overexpression lysate of paired box 2 (PAX2), transcript variant a (as WB positive control) 100 ug
$665.00
LY418301 Transient overexpression lysate of paired box 2 (PAX2), transcript variant c (as WB positive control) 100 ug
$436.00
LY418302 Transient overexpression lysate of paired box 2 (PAX2), transcript variant d (as WB positive control) 100 ug
$436.00
LY418303 Transient overexpression lysate of paired box 2 (PAX2), transcript variant e (as WB positive control) 100 ug
$665.00
LY429172 Transient overexpression lysate of paired box 2 (PAX2), transcript variant a (as WB positive control) 100 ug
$436.00
TP312051 Recombinant protein of human paired box 2 (PAX2), transcript variant a, 20 µg 20 ug
$867.00
TP312112 Recombinant protein of human paired box 2 (PAX2), transcript variant b, 20 µg 20 ug
$867.00
TP318386 Recombinant protein of human paired box 2 (PAX2), transcript variant c, 20 µg 20 ug
$867.00
TP750191 Purified recombinant protein of Human paired box 2 (PAX2), transcript variant a, Phe147-Val235, tag free, expressed in E.coli, 50ug 50 ug
$380.00
TP762411 Purified recombinant protein of Human paired box 2 (PAX2), transcript variant a, Arg266-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products