OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PAX2 (NM_003988) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP318386
Recombinant protein of human paired box 2 (PAX2), transcript variant c, 20 µg
Size:
20 ug 1 mg 100 ug
Formulation:
Liquid Lyophilized
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA899003S PAX2 Rabbit Polyclonal Antibody
30 ul
$188.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PAX2 or NM_003988"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218386 representing NM_003988
Red=Cloning site Green=Tags(s)

MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILG
RYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIR
TKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEG
SVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEV
KSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPEAAVGPSSSL
MSKPGRKLAEVPPCVQPTGASSPATRTATPSTRPTTRLGDSATPPY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003979
Locus ID 5076
UniProt ID Q02962
Cytogenetics 10q24.31
RefSeq Size 4290
RefSeq ORF 1188
Synonyms FSGS7; PAPRS
Summary PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. provided by RefSeq, Dec 2014
Protein Categories Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PAX2" proteins (15)
SKU Description Size Price
PH312051 PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003978) 10 ug
$3,360.00
PH312112 PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_000269) 10 ug
$3,360.00
PH318386 PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003979) 10 ug
$3,360.00
LC400106 Lyophilized PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418300 Lyophilized PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418301 Lyophilized PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418302 Lyophilized PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418303 Lyophilized PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429172 Lyophilized PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400106 Transient overexpression lysate of paired box 2 (PAX2), transcript variant b (as WB positive control) 100 ug
$436.00
LY418300 Transient overexpression lysate of paired box 2 (PAX2), transcript variant a (as WB positive control) 100 ug
$665.00
LY418301 Transient overexpression lysate of paired box 2 (PAX2), transcript variant c (as WB positive control) 100 ug
$436.00
LY418302 Transient overexpression lysate of paired box 2 (PAX2), transcript variant d (as WB positive control) 100 ug
$436.00
LY418303 Transient overexpression lysate of paired box 2 (PAX2), transcript variant e (as WB positive control) 100 ug
$665.00
LY429172 Transient overexpression lysate of paired box 2 (PAX2), transcript variant a (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products