PAX2 (NM_003988) Human Recombinant Protein
SKU
TP318386
Recombinant protein of human paired box 2 (PAX2), transcript variant c, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC218386 representing NM_003988
Red=Cloning site Green=Tags(s) MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILG RYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIR TKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEG SVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEV KSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPEAAVGPSSSL MSKPGRKLAEVPPCVQPTGASSPATRTATPSTRPTTRLGDSATPPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_003979 |
Locus ID | 5076 |
UniProt ID | Q02962 |
Cytogenetics | 10q24.31 |
RefSeq Size | 4290 |
RefSeq ORF | 1188 |
Synonyms | FSGS7; PAPRS |
Summary | PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2014] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH312051 | PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003978) | 10 ug |
$3,255.00
|
|
PH312112 | PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_000269) | 10 ug |
$3,255.00
|
|
PH318386 | PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003979) | 10 ug |
$3,255.00
|
|
LC400106 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC418300 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC418301 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC418302 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC418303 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC429172 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400106 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant b | 100 ug |
$436.00
|
|
LY418300 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant a | 100 ug |
$665.00
|
|
LY418301 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant c | 100 ug |
$436.00
|
|
LY418302 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant d | 100 ug |
$436.00
|
|
LY418303 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant e | 100 ug |
$665.00
|
|
LY429172 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant a | 100 ug |
$436.00
|
|
TP312051 | Recombinant protein of human paired box 2 (PAX2), transcript variant a, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP312112 | Recombinant protein of human paired box 2 (PAX2), transcript variant b, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP750191 | Purified recombinant protein of Human paired box 2 (PAX2), transcript variant a, Phe147-Val235, tag free, expressed in E.coli, 50ug | 50 ug |
$362.00
|
|
TP762411 | Purified recombinant protein of Human paired box 2 (PAX2), transcript variant a, Arg266-End, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$249.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.