PAX2 (NM_003987) Human Mass Spec Standard

SKU
PH312051
PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003978)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212051]
Predicted MW 44.5 kDa
Protein Sequence
Protein Sequence
>RC212051 representing NM_003987
Red=Cloning site Green=Tags(s)

MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILG
RYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIR
TKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEVEVYT
DPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQAS
EHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQ
GSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRSAPAAAAAAYDRH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003978
RefSeq Size 4276
RefSeq ORF 1248
Synonyms FSGS7; PAPRS
Locus ID 5076
UniProt ID Q02962
Cytogenetics 10q24.31
Summary PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2014]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PAX2 (NM_003987) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312112 PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_000269) 10 ug
$3,255.00
PH318386 PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003979) 10 ug
$3,255.00
LC400106 PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418300 PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418301 PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418302 PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418303 PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429172 PAX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400106 Transient overexpression lysate of paired box 2 (PAX2), transcript variant b 100 ug
$436.00
LY418300 Transient overexpression lysate of paired box 2 (PAX2), transcript variant a 100 ug
$665.00
LY418301 Transient overexpression lysate of paired box 2 (PAX2), transcript variant c 100 ug
$436.00
LY418302 Transient overexpression lysate of paired box 2 (PAX2), transcript variant d 100 ug
$436.00
LY418303 Transient overexpression lysate of paired box 2 (PAX2), transcript variant e 100 ug
$665.00
LY429172 Transient overexpression lysate of paired box 2 (PAX2), transcript variant a 100 ug
$436.00
TP312051 Recombinant protein of human paired box 2 (PAX2), transcript variant a, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312112 Recombinant protein of human paired box 2 (PAX2), transcript variant b, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318386 Recombinant protein of human paired box 2 (PAX2), transcript variant c, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP750191 Purified recombinant protein of Human paired box 2 (PAX2), transcript variant a, Phe147-Val235, tag free, expressed in E.coli, 50ug 50 ug
$362.00
TP762411 Purified recombinant protein of Human paired box 2 (PAX2), transcript variant a, Arg266-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.