OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRICKLE4 (NM_013397) Human Mass Spec Standard

Be the first to review this product
SKU
PH311641
PRICKLE4 MS Standard C13 and N15-labeled recombinant protein (NP_037529)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA319905 Rabbit Polyclonal PRICKLE4 Antibody
100 ug
$640.00
LY415617 Transient overexpression lysate of prickle homolog 4 (Drosophila) (PRICKLE4) (as WB positive control) 100 ug
$436.00

Other products for "PRICKLE4 or NM_013397"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211641
Predicted MW 41.6 kDa
Protein Sequence
Protein Sequence
>RC211641 representing NM_013397
Red=Cloning site Green=Tags(s)

MSVQNSGWPHQEDSPKPQDPGPPANSDSDSGHLPGEDPEDTHAQGPAVLSLGSLCLDTNQAPNWTGLQTL
LQQLPPQDIDERYCLALGEEERAELQLFCARRKQEALGQGVARLVLPKLEGHTCEKCRELLKPGEYGVFA
ARAGEQRCWHQPCFACQACGQALINLIYFYHDGQLYCGRHHAELLRPRCPACDQLIFSWRCTEAEGQRWH
ENHFCCQDCAGPLGGGRYALPGGSPCCPSCFENRYSDAGSSWAGALEGQAFLGETGLDRTEGRDQTSVNS
ATLSRTLLAAAGGSSLQTQRGLPGSSPQQENRPGDKAEAPKGQEQCRLETIRDPKDTPFSTCSSSSDSEP
EGFFLGERLPQSWKTPGSLQAEDSNASKTHCTMC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037529
RefSeq Size 2542
RefSeq ORF 1152
Synonyms C6orf49; OBTP; OEBT; TOMM6
Locus ID 29964
UniProt ID Q2TBC4
Cytogenetics 6p21.1
Summary C6ORF49 is a member of the LIM domain protein family (Teufel et al., 2005 PubMed 15702247).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRICKLE4" proteins (3)
SKU Description Size Price
LC415617 Lyophilized PRICKLE4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415617 Transient overexpression lysate of prickle homolog 4 (Drosophila) (PRICKLE4) (as WB positive control) 100 ug
$436.00
TP311641 Recombinant protein of human prickle homolog 4 (Drosophila) (PRICKLE4), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products