OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PF4 (NM_002619) Human Mass Spec Standard

Be the first to review this product
SKU
PH311322
PF4 MS Standard C13 and N15-labeled recombinant protein (NP_002610)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA367497 PF4 rabbit polyclonal antibody
100 ul
$310.00
LY400930 Transient overexpression lysate of platelet factor 4 (PF4) (as WB positive control) 100 ug
$436.00

Other products for "PF4 or NM_002619"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211322
Predicted MW 10.8 kDa
Protein Sequence
Protein Sequence
>RC211322 protein sequence
Red=Cloning site Green=Tags(s)

MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTA
QLIATLKNGRKICLDLQAPLYKKIIKKLLES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002610
RefSeq Size 878
RefSeq ORF 303
Synonyms CXCL4; PF-4; SCYB4
Locus ID 5196
UniProt ID P02776
Cytogenetics 4q13.3
Summary This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is chemotactic for numerous other cell type and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. The protein also exhibits antimicrobial activity against Plasmodium falciparum. provided by RefSeq, Oct 2014
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PF4" proteins (3)
SKU Description Size Price
LC400930 Lyophilized PF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400930 Transient overexpression lysate of platelet factor 4 (PF4) (as WB positive control) 100 ug
$436.00
TP311322 Recombinant protein of human platelet factor 4 (PF4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products