OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD153 (TNFSF8) (NM_001244) Human Mass Spec Standard

Be the first to review this product
SKU
PH311276
TNFSF8 MS Standard C13 and N15-labeled recombinant protein (NP_001235)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA358538 TNFSF8 Antibody - N-terminal region
100 ul
$585.00
LY420051 Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8) (as WB positive control) 100 ug
$436.00

Other products for "CD153 or NM_001244"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211276
Predicted MW 26 kDa
Protein Sequence
Protein Sequence
>RC211276 protein sequence
Red=Cloning site Green=Tags(s)

MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPN
SPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYF
IICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDT
FQYIDTSTFPLENVLSIFLYSNSD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001235
RefSeq Size 3797
RefSeq ORF 702
Synonyms CD30L; CD30LG; CD153; TNLG3A
Locus ID 944
UniProt ID P32971
Cytogenetics 9q32-q33.1
Summary The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Nov 2011
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD153" proteins (4)
SKU Description Size Price
LC420051 Lyophilized TNFSF8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420051 Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8) (as WB positive control) 100 ug
$436.00
TP311276 Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8), 20 µg 20 ug
$867.00
TP723961 Recombinant human CD30 Ligand Protein with N-terminal mouse Fc and C-terminal 6×His tag 100 ug
$795.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products