LRPAP1 (NM_002337) Human Mass Spec Standard

CAT#: PH311255

LRPAP1 MS Standard C13 and N15-labeled recombinant protein (NP_002328)

Product Images

Coomassie blue staining of purified LRPAP1 protein (Cat# TP311255). The protein was produced from HEK293T cells transfected with LRPAP1 cDNA clone (Cat# RC211255) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211255
• Predicted MW: 41.5 kDa
• Protein Sequence:
  Sequence Link

  >RC211255 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLH
  LPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSG
  TQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLS
  DIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREE
  LKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRIS
  RARHNEL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002328
• RefSeq Size: 10536
• RefSeq ORF: 1071
• Synonyms: A2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
• Locus ID: 4043
• UniProt ID: P30533
• Cytogenetics: 4p16.3
• Summary: This gene encodes a protein that interacts with the low density lipoprotein (LDL) receptor-related protein and facilitates its proper folding and localization by preventing the binding of ligands. Mutations in this gene have been identified in individuals with myopia 23. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
• Protein Families: Druggable Genome, Transmembrane