OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tuberoinfundibular peptide (PTH2) (NM_178449) Human Mass Spec Standard

Be the first to review this product
SKU
PH310906
PTH2 MS Standard C13 and N15-labeled recombinant protein (NP_848544)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337573 Rabbit Polyclonal Anti-PTH2 Antibody
100 ul
$585.00
LY403603 Transient overexpression lysate of parathyroid hormone 2 (PTH2) (as WB positive control) 100 ug
$436.00

Other products for "Tuberoinfundibular peptide or NM_178449"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210906
Predicted MW 11.2 kDa
Protein Sequence
Protein Sequence
>RC210906 protein sequence
Red=Cloning site Green=Tags(s)

METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAA
FRERARLLAALERRHWLNSYMHKLLVLDAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_848544
RefSeq Size 459
RefSeq ORF 300
Synonyms TIP39
Locus ID 113091
UniProt ID Q96A98
Cytogenetics 19q13.33
Summary This gene encodes the precursor of a peptide hormone that shares sequence similarity with the parathyroid hormone. This gene is expressed in various regions of the brain where it plays a role in the release of pituitary hormones, anxiety and nociception. The encoded precursor protein is proteolytically processed to generate the biologically active neuropeptide. provided by RefSeq, Jul 2015
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Tuberoinfundibular peptide" proteins (3)
SKU Description Size Price
LC403603 Lyophilized PTH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403603 Transient overexpression lysate of parathyroid hormone 2 (PTH2) (as WB positive control) 100 ug
$436.00
TP310906 Recombinant protein of human parathyroid hormone 2 (PTH2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products