OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GPHA2 (NM_130769) Human Mass Spec Standard

Be the first to review this product
SKU
PH310893
GPHA2 MS Standard C13 and N15-labeled recombinant protein (NP_570125)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY408932 Transient overexpression lysate of glycoprotein hormone alpha 2 (GPHA2) (as WB positive control) 100 ug
$436.00

Other products for "GPHA2 or NM_130769"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210893
Predicted MW 14.2 kDa
Protein Sequence
Protein Sequence
>RC210893 protein sequence
Red=Cloning site Green=Tags(s)

MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRY
SVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_570125
RefSeq Size 774
RefSeq ORF 387
Synonyms A2; GPA2; ZSIG51
Locus ID 170589
UniProt ID Q96T91
Cytogenetics 11q13.1
Summary GPHA2 is a cystine knot-forming polypeptide and a subunit of the dimeric glycoprotein hormone family (Hsu et al., 2002 PubMed 12089349).supplied by OMIM, Mar 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GPHA2" proteins (3)
SKU Description Size Price
LC408932 Lyophilized GPHA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408932 Transient overexpression lysate of glycoprotein hormone alpha 2 (GPHA2) (as WB positive control) 100 ug
$436.00
TP310893 Recombinant protein of human glycoprotein hormone alpha 2 (GPHA2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products