OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD200R (CD200R1) (NM_170780) Human Mass Spec Standard

Be the first to review this product
SKU
PH310870
CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_740750)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349768 Rabbit Polyclonal Anti-CD200R1 Antibody
100 ul
$205.00
LY408492 Transient overexpression lysate of CD200 receptor 1 (CD200R1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CD200R or NM_170780"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210870
Predicted MW 36.6 kDa
Protein Sequence
Protein Sequence
>RC210870 protein sequence
Red=Cloning site Green=Tags(s)

MLCPWRTANLGLLLILTIFLVAASSSLCMDEKQITQNYSKVLAEVNTSWPVKMATNAVLCCPPIALRNLI
IITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDLQIRTVAITHDGYYRCIMVTPDGN
FHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAHISWIPEGDCATKQEYWSNGTVTVKSTCHWEVHN
VSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTEST
PVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_740750
RefSeq Size 2203
RefSeq ORF 975
Synonyms CD200R; HCRTR2; MOX2R; OX2R
Locus ID 131450
UniProt ID Q8TD46
Cytogenetics 3q13.2
Summary This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD200R" proteins (8)
SKU Description Size Price
PH310223 CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_620161) 10 ug
$3,360.00
LC406878 Lyophilized CD200R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408492 Lyophilized CD200R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406878 Transient overexpression lysate of CD200 receptor 1 (CD200R1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY408492 Transient overexpression lysate of CD200 receptor 1 (CD200R1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310223 Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 1, 20 µg 20 ug
$867.00
TP310870 Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 4, 20 µg 20 ug
$867.00
TP720280 Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 1 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products