CD200R (CD200R1) (NM_138806) Human Recombinant Protein

SKU
TP310223
Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210223 protein sequence
Red=Cloning site Green=Tags(s)

MLCPWRTANLGLLLILTIFLVAEAEGAAQPNNSLMLQTSKENHALASSSLCMDEKQITQNYSKVLAEVNT
SWPVKMATNAVLCCPPIALRNLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL
QIRTVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAHISWIPEGDCA
TKQEYWSNGTVTVKSTCHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIILTIIILTI
VGFIWLLKVNGCRKYKLNKTESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_620161
Locus ID 131450
UniProt ID Q8TD46
Cytogenetics 3q13.2
RefSeq Size 2272
RefSeq ORF 1044
Synonyms CD200R; HCRTR2; MOX2R; OX2R
Summary This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:CD200R (CD200R1) (NM_138806) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310223 CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_620161) 10 ug
$3,255.00
PH310870 CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_740750) 10 ug
$3,255.00
LC406878 CD200R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408492 CD200R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406878 Transient overexpression lysate of CD200 receptor 1 (CD200R1), transcript variant 4 100 ug
$436.00
LY408492 Transient overexpression lysate of CD200 receptor 1 (CD200R1), transcript variant 1 100 ug
$436.00
TP310870 Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720280 Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 1 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.