CD200R (CD200R1) (NM_138806) Human Mass Spec Standard

SKU
PH310223
CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_620161)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210223]
Predicted MW 39 kDa
Protein Sequence
Protein Sequence
>RC210223 protein sequence
Red=Cloning site Green=Tags(s)

MLCPWRTANLGLLLILTIFLVAEAEGAAQPNNSLMLQTSKENHALASSSLCMDEKQITQNYSKVLAEVNT
SWPVKMATNAVLCCPPIALRNLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL
QIRTVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAHISWIPEGDCA
TKQEYWSNGTVTVKSTCHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIILTIIILTI
VGFIWLLKVNGCRKYKLNKTESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620161
RefSeq Size 2272
RefSeq ORF 1044
Synonyms CD200R; HCRTR2; MOX2R; OX2R
Locus ID 131450
UniProt ID Q8TD46
Cytogenetics 3q13.2
Summary This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:CD200R (CD200R1) (NM_138806) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310870 CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_740750) 10 ug
$3,255.00
LC406878 CD200R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408492 CD200R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406878 Transient overexpression lysate of CD200 receptor 1 (CD200R1), transcript variant 4 100 ug
$436.00
LY408492 Transient overexpression lysate of CD200 receptor 1 (CD200R1), transcript variant 1 100 ug
$436.00
TP310223 Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP310870 Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720280 Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 1 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.