CD200R (CD200R1) (NM_138806) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC210223
CD200R1 (Myc-DDK-tagged)-Human CD200 receptor 1 (CD200R1), transcript variant 1
$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD200R
Synonyms CD200R; HCRTR2; MOX2R; OX2R
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210223 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCTGCCCTTGGAGAACTGCTAACCTAGGGCTACTGTTGATTTTGACTATCTTCTTAGTGGCCGAAG
CGGAGGGTGCTGCTCAACCAAACAACTCATTAATGCTGCAAACTAGCAAGGAGAATCATGCTTTAGCTTC
AAGCAGTTTATGTATGGATGAAAAACAGATTACACAGAACTACTCGAAAGTACTCGCAGAAGTTAACACT
TCATGGCCTGTAAAGATGGCTACAAATGCTGTGCTTTGTTGCCCTCCTATCGCATTAAGAAATTTGATCA
TAATAACATGGGAAATAATCCTGAGAGGCCAGCCTTCCTGCACAAAAGCCTACAAGAAAGAAACAAATGA
GACCAAGGAAACCAACTGTACTGATGAGAGAATAACCTGGGTCTCCAGACCTGATCAGAATTCGGACCTT
CAGATTCGTACCGTGGCCATCACTCATGACGGGTATTACAGATGCATAATGGTAACACCTGATGGGAATT
TCCATCGTGGATATCACCTCCAAGTGTTAGTTACACCTGAAGTGACCCTGTTTCAAAACAGGAATAGAAC
TGCAGTATGCAAGGCAGTTGCAGGGAAGCCAGCTGCGCATATCTCCTGGATCCCAGAGGGCGATTGTGCC
ACTAAGCAAGAATACTGGAGCAATGGCACAGTGACTGTTAAGAGTACATGCCACTGGGAGGTCCACAATG
TGTCTACCGTGACCTGCCACGTCTCCCATTTGACTGGCAACAAGAGTCTGTACATAGAGCTACTTCCTGT
TCCAGGTGCCAAAAAATCAGCAAAATTATATATTCCATATATCATCCTTACTATTATTATTTTGACCATC
GTGGGATTCATTTGGTTGTTGAAAGTCAATGGCTGCAGAAAATATAAATTGAATAAAACAGAATCTACTC
CAGTTGTTGAGGAGGATGAAATGCAGCCCTATGCCAGCTACACAGAGAAGAACAATCCTCTCTATGATAC
TACAAACAAGGTGAAGGCATCTGAGGCATTACAAAGTGAAGTTGACACAGACCTCCATACTTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210223 protein sequence
Red=Cloning site Green=Tags(s)

MLCPWRTANLGLLLILTIFLVAEAEGAAQPNNSLMLQTSKENHALASSSLCMDEKQITQNYSKVLAEVNT
SWPVKMATNAVLCCPPIALRNLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL
QIRTVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAHISWIPEGDCA
TKQEYWSNGTVTVKSTCHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIILTIIILTI
VGFIWLLKVNGCRKYKLNKTESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138806
ORF Size 1044 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138806.4
RefSeq Size 2272 bp
RefSeq ORF 1047 bp
Locus ID 131450
UniProt ID Q8TD46
Cytogenetics 3q13.2
Protein Families Druggable Genome, Transmembrane
MW 39 kDa
Summary This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
RC210223L1 Lenti ORF clone of Human CD200 receptor 1 (CD200R1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC210223L2 Lenti ORF clone of Human CD200 receptor 1 (CD200R1), transcript variant 1, mGFP tagged 10 ug
$757.00
RC210223L3 Lenti ORF clone of Human CD200 receptor 1 (CD200R1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC210223L4 Lenti ORF clone of Human CD200 receptor 1 (CD200R1), transcript variant 1, mGFP tagged 10 ug
$757.00
RG210223 CD200R1 (tGFP-tagged) - Human CD200 receptor 1 (CD200R1), transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC120610 CD200R1 (untagged)-Human CD200 receptor 1 (CD200R1), transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.