OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF122 (NM_024787) Human Mass Spec Standard

Be the first to review this product
SKU
PH310868
RNF122 MS Standard C13 and N15-labeled recombinant protein (NP_079063)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411049 Transient overexpression lysate of ring finger protein 122 (RNF122) (as WB positive control) 100 ug
$436.00

Other products for "RNF122 or NM_024787"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210868
Predicted MW 17.5 kDa
Protein Sequence
Protein Sequence
>RC210868 protein sequence
Red=Cloning site Green=Tags(s)

MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSE
RYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASP
SEATQNIGILLDELV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079063
RefSeq Size 1872
RefSeq ORF 465
Locus ID 79845
UniProt ID Q9H9V4
Cytogenetics 8p12
Summary The encoded protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The encoded protein is localized to the endoplasmic reticulum and golgi apparatus, and may be associated with cell viability. provided by RefSeq, Jul 2013
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNF122" proteins (3)
SKU Description Size Price
LC411049 Lyophilized RNF122 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411049 Transient overexpression lysate of ring finger protein 122 (RNF122) (as WB positive control) 100 ug
$436.00
TP310868 Recombinant protein of human ring finger protein 122 (RNF122), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products