RNF122 (NM_024787) Human Recombinant Protein

SKU
TP310868
Recombinant protein of human ring finger protein 122 (RNF122), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210868 protein sequence
Red=Cloning site Green=Tags(s)

MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSE
RYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASP
SEATQNIGILLDELV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_079063
Locus ID 79845
UniProt ID Q9H9V4
Cytogenetics 8p12
RefSeq Size 1872
RefSeq ORF 465
Summary The encoded protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The encoded protein is localized to the endoplasmic reticulum and golgi apparatus, and may be associated with cell viability. [provided by RefSeq, Jul 2013]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:RNF122 (NM_024787) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310868 RNF122 MS Standard C13 and N15-labeled recombinant protein (NP_079063) 10 ug
$3,255.00
LC411049 RNF122 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411049 Transient overexpression lysate of ring finger protein 122 (RNF122) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.