RNF122 (NM_024787) Human Mass Spec Standard

SKU PH310868

RNF122 MS Standard C13 and N15-labeled recombinant protein (NP_079063)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210868]
• Predicted MW: 17.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC210868 protein sequence; Red=Cloning site Green=Tags(s); ; MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSE; RYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASP; SEATQNIGILLDELV; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_079063
• RefSeq Size: 1872
• RefSeq ORF: 465
• Locus ID: 79845
• UniProt ID: Q9H9V4
• Cytogenetics: 8p12
• Summary: The encoded protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The encoded protein is localized to the endoplasmic reticulum and golgi apparatus, and may be associated with cell viability. [provided by RefSeq, Jul 2013]
• Protein Families: Druggable Genome, Transmembrane