OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LECT2 (NM_002302) Human Mass Spec Standard

Be the first to review this product
SKU
PH310790
LECT2 MS Standard C13 and N15-labeled recombinant protein (NP_002293)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA504091 LECT2 mouse monoclonal antibody, clone OTI2A11 (formerly 2A11) 100 ul
$447.00

Other products for "LECT2 or NM_002302"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210790
Predicted MW 16.4 kDa
Protein Sequence
Protein Sequence
>RC210790 protein sequence
Red=Cloning site Green=Tags(s)

MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPF
TGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIE
NCDSSDPTAYL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002293
RefSeq Size 1077
RefSeq ORF 453
Synonyms chm-II; chm2
Locus ID 3950
UniProt ID O14960
Cytogenetics 5q31.1
Summary This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LECT2" proteins (2)
SKU Description Size Price
TP310790 Recombinant protein of human leukocyte cell-derived chemotaxin 2 (LECT2), 20 µg 20 ug
$867.00
TP750168 Purified recombinant protein of Human leukocyte cell-derived chemotaxin 2 (LECT2), Gly19-End, Tag free, expressed in E.coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products