LECT2 (NM_002302) Human Tagged ORF Clone

SKU
RC210790
LECT2 (Myc-DDK-tagged)-Human leukocyte cell-derived chemotaxin 2 (LECT2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
5 Days*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LECT2
Synonyms chm-II; chm2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210790 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTTCCACCAAAGCCCTCCTTTTGGCTGGTCTGATTTCTACCGCACTGGCAGGGCCATGGGCTAATA
TATGTGCTGGCAAGTCTTCCAATGAGATCCGGACGTGTGACCGCCATGGCTGTGGACAGTACTCTGCTCA
AAGAAGTCAGAGGCCTCACCAGGGTGTGGACGTCTTGTGCTCTGCTGGATCTACTGTGTACGCACCATTC
ACTGGAATGATTGTGGGCCAGGAGAAACCTTATCAAAACAAGAATGCTATCAATAATGGTGTTCGAATAT
CTGGAAGAGGTTTTTGTGTCAAAATGTTCTACATTAAGCCAATTAAGTATAAAGGTCCTATTAAGAAGGG
AGAAAAACTTGGAACTCTATTGCCCTTGCAGAAAGTTTATCCTGGCATACAATCGCATGTGCACATTGAA
AACTGTGACTCGAGTGACCCTACTGCATACCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210790 protein sequence
Red=Cloning site Green=Tags(s)

MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPF
TGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIE
NCDSSDPTAYL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002302
ORF Size 453 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002302.1
RefSeq Size 1077 bp
RefSeq ORF 456 bp
Locus ID 3950
UniProt ID O14960
Cytogenetics 5q31.1
Protein Families Druggable Genome, Secreted Protein
MW 16.4 kDa
Summary This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:LECT2 (NM_002302) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210790L1 Lenti ORF clone of Human leukocyte cell-derived chemotaxin 2 (LECT2), Myc-DDK-tagged 10 ug
$450.00
RC210790L2 Lenti ORF clone of Human leukocyte cell-derived chemotaxin 2 (LECT2), mGFP tagged 10 ug
$450.00
RC210790L3 Lenti ORF clone of Human leukocyte cell-derived chemotaxin 2 (LECT2), Myc-DDK-tagged 10 ug
$450.00
RC210790L4 Lenti ORF clone of Human leukocyte cell-derived chemotaxin 2 (LECT2), mGFP tagged 10 ug
$450.00
RG210790 LECT2 (tGFP-tagged) - Human leukocyte cell-derived chemotaxin 2 (LECT2) 10 ug
$489.00
SC303173 LECT2 (untagged)-Human leukocyte cell-derived chemotaxin 2 (LECT2) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.