SPCS2 (NM_014752) Human Mass Spec Standard

CAT#: PH310745

SPCS2 MS Standard C13 and N15-labeled recombinant protein (NP_055567)

Product Images

Coomassie blue staining of purified SPCS2 protein (Cat# TP310745). The protein was produced from HEK293T cells transfected with SPCS2 cDNA clone (Cat# RC210745) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210745
• Predicted MW: 25 kDa
• Protein Sequence:
  Sequence Link

  >RC210745 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLE
  KYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIF
  LVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEP
  EISRLHDSLAIERKIK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055567
• RefSeq Size: 2731
• RefSeq ORF: 678
• Locus ID: 9789
• UniProt ID: Q15005
• Cytogenetics: 11q13.4
• Summary: Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function]
• Protein Families: Protease, Transmembrane