SPCS2 (NM_014752) Human Recombinant Protein

SKU
TP310745
Recombinant protein of human signal peptidase complex subunit 2 homolog (S. cerevisiae) (SPCS2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210745 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLE
KYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIF
LVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEP
EISRLHDSLAIERKIK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055567
Locus ID 9789
UniProt ID Q15005
Cytogenetics 11q13.4
RefSeq Size 2731
RefSeq ORF 678
Summary Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function]
Protein Families Protease, Transmembrane
Write Your Own Review
You're reviewing:SPCS2 (NM_014752) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310745 SPCS2 MS Standard C13 and N15-labeled recombinant protein (NP_055567) 10 ug
$3,255.00
LC415050 SPCS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415050 Transient overexpression lysate of signal peptidase complex subunit 2 homolog (S. cerevisiae) (SPCS2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.