RALY (NM_016732) Human Mass Spec Standard

CAT#: PH310723

RALY MS Standard C13 and N15-labeled recombinant protein (NP_057951)

Product images

Specifications

Product Data

• Description: RALY MS Standard C13 and N15-labeled recombinant protein (NP_057951)
• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210723
• Predicted MW: 32.6 kDa
• Protein Sequence:
  Sequence Link

  >RC210723 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARA
  AVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYRDDFYDRLFDYRGRLSPVPVP
  RAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSNIDALLSRLEQ
  IAAEQKANPDGKKKGDGGGASGGGGGGGGSGGGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDG
  DEEGLLTHSEEELEHSQDTDADDGALQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057951
• RefSeq Size: 4790
• RefSeq ORF: 921
• Synonyms: HNRPCL2; P542
• Locus ID: 22913
• Cytogenetics: 20q11.22
• Summary: This gene encodes a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) gene family. This protein may play a role in pre-mRNA splicing and in embryonic development. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]