OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RALY (NM_016732) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210723
RALY (Myc-DDK-tagged)-Human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA331901 Rabbit Polyclonal Anti-RALY Antibody
100 ul
$525.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RALY or NM_016732"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RALY
Synonyms HNRPCL2; P542
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210723 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTTGAAGCTTCAGGCAAGCAATGTAACCAACAAGAATGACCCCAAGTCCATCAACTCTCGAGTCT
TCATTGGAAACCTCAACACAGCTCTGGTGAAGAAATCAGATGTGGAGACCATCTTCTCTAAGTATGGCCG
TGTGGCCGGCTGTTCTGTGCACAAGGGCTATGCCTTTGTTCAGTACTCCAATGAGCGCCATGCCCGGGCA
GCTGTGCTGGGAGAGAATGGGCGGGTGCTGGCCGGGCAGACCCTGGACATCAACATGGCTGGAGAGCCTA
AGCCTGACAGACCCAAGGGGCTAAAGAGAGCAGCATCTGCCATATACAGTGGCTACATCTTTGACTATGA
TTACTACCGGGACGACTTCTACGACAGGCTCTTCGACTACCGGGGCCGTCTGTCGCCCGTGCCAGTGCCC
AGGGCGGTCCCTGTGAAGCGACCCCGGGTCACAGTCCCTTTGGTCCGGCGTGTCAAAACTAACGTACCTG
TCAAGCTCTTTGCCCGCTCCACAGCTGTCACCACCAGCTCAGCCAAGATCAAGTTAAAGAGCAGTGAGCT
GCAGGCCATCAAGACGGAGCTGACACAGATCAAGTCCAATATCGATGCCCTGCTGAGCCGCTTGGAGCAG
ATCGCTGCGGAGCAAAAGGCCAATCCAGATGGCAAGAAGAAGGGTGATGGAGGTGGCGCCAGCGGCGGCG
GCGGCGGTGGTGGTGGCAGCGGTGGCGGTGGCAGTGGTGGTGGCGGTGGCGGTGGCAGCAGCCGGCCACC
AGCCCCCCAAGAGAACACAACTTCTGAGGCAGGCCTGCCCCAGGGGGAAGCACGGACCCGAGACGACGGC
GATGAGGAAGGGCTCCTGACACACAGCGAGGAAGAGCTGGAACACAGCCAGGACACAGACGCGGATGATG
GGGCCTTGCAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210723 protein sequence
Red=Cloning site Green=Tags(s)

MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARA
AVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYRDDFYDRLFDYRGRLSPVPVP
RAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSNIDALLSRLEQ
IAAEQKANPDGKKKGDGGGASGGGGGGGGSGGGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDG
DEEGLLTHSEEELEHSQDTDADDGALQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_016732
ORF Size 921 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016732.3
RefSeq Size 4790 bp
RefSeq ORF 921 bp
Locus ID 22913
UniProt ID Q9UKM9, Q53GL6
Cytogenetics 20q11.22
Domains RRM
MW 32.6 kDa
Summary This gene encodes a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) gene family. This protein may play a role in pre-mRNA splicing and in embryonic development. Alternate splicing results in multiple transcript variants. provided by RefSeq, Sep 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_016732" in other vectors (7)
SKU Description Size Price
RC210723L1 Lenti ORF clone of Human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210723L2 Lenti ORF clone of Human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1, mGFP tagged 10 ug
$600.00
RC210723L3 Lenti ORF clone of Human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210723L4 Lenti ORF clone of Human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1, mGFP tagged 10 ug
$600.00
RG210723 RALY (tGFP-tagged) - Human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1 10 ug
$489.00 $500.00
SC114148 RALY (untagged)-Human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1 10 ug
$300.00
SC322780 RALY (untagged)-Human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 1 10 ug
$300.00

Plasmid Map for RC210723

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC210723
Circular map for RC210723

file-alt Citations

CCR5AS lncRNA variation differentially regulates CCR5, influencing HIV disease outcome
Kulkarni, Lied, Kulkarni et al
Nat. Immunol. (2019) 20 (7), 824-834 DOI: 10.1038/s41590-019-0406-1
AI Summary: In this study, the OriGene Raly cDNA Myc-tagged plasmid (clone RC210723) was used to investigate the role of the RNA-binding protein Raly in regulating CCR5 mRNA stability and its impact on HIV infection.
Snippet: Hut-78 were transfected with a plasmid encoding Raly cDNA with a Myc-tag (clone RC210723;Origene) along with either siCon1 or siLnc1. For RIP of ribonucleoprotein complexes from whole-cell extracts, the transfected cells were lysed in 20 mM Tris–HCl at pH 7.5, 100 mM KCl, 5 mM MgCl2 and 0.5% Nonidet P-40 for 10 min on ice and centrifuged at 10,000 r.p.m. for 15 min at 4 °C
FigureFigureFigure
IP
The hnRNP RALY regulates transcription and cell proliferation by modulating the expression of specific factors, including the proliferation-marker E2F1
Cornella, Tebaldi, Gasperini et al
J. Biol. Chem. (2017)
AI Summary: OriGene’s pCMV6-Entry Vector was used to clone human RALY cDNA with a c-Myc/DDK tag, enabling the study of RALY’s role in regulating gene expression and cell proliferation in this research.
Snippet: Constructs. Reverse transcription was performed on total RNA isolated from HeLa cells using the TRIzol Reagent. Human RALY cDNA was amplified with the Phusion High-Fidelity DNA polymerase (New England BioLabs), and then cloned in frame with the c-Myc/DDK tag (pCMV6-Entry Vector, Origene). The sequences of the primers are listed in the Supplementary Table S3
Heterogeneous nuclear ribonucleoprotein C proteins interact with the human papillomavirus type 16 (HPV16) early 3'-untranslated region and alleviate suppression of HPV16 late L1 mRNA splicing
Dhanjal, Kajitani, Glahder et al
J. Biol. Chem. (2015)
AI Summary: OriGene products contributed to this study by providing CMV promoter-driven expression plasmids for myc-tagged-RALY (RC210723) and myc-tagged-RALYL (RC206313), which were used to investigate their roles in regulating HPV16 late gene expression.
Snippet: CMV promoter-driven expression plasmids for myc-tagged-RALY (RC210723) and myc-tagged-RALYL (RC206313) were purchased from Origene. To construct RALYL deletion mutant pCRALYL-C the N-terminus was PCR ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products