OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSDL2 (NM_032303) Human Mass Spec Standard

Be the first to review this product
SKU
PH310663
HSDL2 MS Standard C13 and N15-labeled recombinant protein (NP_115679)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410245 Transient overexpression lysate of hydroxysteroid dehydrogenase like 2 (HSDL2) (as WB positive control) 100 ug
$436.00

Other products for "HSDL2 or NM_032303"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210663
Predicted MW 45.4 kDa
Protein Sequence
Protein Sequence
>RC210663 protein sequence
Red=Cloning site Green=Tags(s)

MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALP
CIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYL
KKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLG
GPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEA
VSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLK
SKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115679
RefSeq Size 3393
RefSeq ORF 1254
Synonyms C9orf99; SDR13C1
Locus ID 84263
UniProt ID Q6YN16
Cytogenetics 9q32
Summary Has apparently no steroid dehydrogenase activity.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSDL2" proteins (5)
SKU Description Size Price
LC410245 Lyophilized HSDL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433809 Lyophilized HSDL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410245 Transient overexpression lysate of hydroxysteroid dehydrogenase like 2 (HSDL2) (as WB positive control) 100 ug
$436.00
LY433809 Transient overexpression lysate of hydroxysteroid dehydrogenase like 2 (HSDL2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP310663 Recombinant protein of human hydroxysteroid dehydrogenase like 2 (HSDL2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products