OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TSPY3 (NM_001077697) Human Mass Spec Standard

Be the first to review this product
SKU
PH310427
TSPY3 MS Standard C13 and N15-labeled recombinant protein (NP_001071165)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA382909 TSPY3 Rabbit polyclonal Antibody
100 ul
$410.00
LY421481 Transient overexpression lysate of testis specific protein, Y-linked 3 (TSPY3) (as WB positive control) 100 ug
$436.00

Other products for "TSPY3 or NM_001077697"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210427
Predicted MW 35.1 kDa
Protein Sequence
Protein Sequence
>RC210427 protein sequence
Red=Cloning site Green=Tags(s)

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDI
MAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERR
RKPQLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPY
FQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDL
WRNPLQYYKRMKPPEEGTETSGDSQLLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001071165
RefSeq Size 1161
RefSeq ORF 924
Synonyms CT78; TSPY; TSPY1; TSPY10
Locus ID 728137
UniProt ID Q01534
Cytogenetics Yp11.2
Summary May be involved in sperm differentiation and proliferation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TSPY3" proteins (3)
SKU Description Size Price
LC421481 Lyophilized TSPY3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421481 Transient overexpression lysate of testis specific protein, Y-linked 3 (TSPY3) (as WB positive control) 100 ug
$436.00
TP310427 Recombinant protein of human testis specific protein, Y-linked 3 (TSPY3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products