OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRPH2 (NM_000322) Human Mass Spec Standard

Be the first to review this product
SKU
PH310357
PRPH2 MS Standard C13 and N15-labeled recombinant protein (NP_000313)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY400122 Transient overexpression lysate of peripherin 2 (retinal degeneration, slow) (PRPH2) (as WB positive control) 100 ug
$436.00

Other products for "PRPH2 or NM_000322"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210357
Predicted MW 39.1 kDa
Protein Sequence
Protein Sequence
>RC210357 protein sequence
Red=Cloning site Green=Tags(s)

MALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFSLGLFLKIGLRKRSDVMNNSESHFVPNSLIGMGVL
SCVFNSLAGKICYDALDPAKYARWKPWLKPYLAICVLFNIILFLVALCCFLLRGSLENTLGQGLKNGMKY
YRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWISNRYLDFSSKEVKDRIKSNVDGRYLVDGVP
FSCCNPSSPRPCIQYQITNNSAHYSYDHQTEELNLWVRGCRAALLSYYSSLMNSMGVVTLLIWLFEVTIT
IGLRYLQTSLDGVSNPEESESESEGWLLEKSVPETWKAFLESVKKLGKGNQVEAEGAGAGQAPEAG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000313
RefSeq Size 3027
RefSeq ORF 1038
Synonyms AOFMD; AVMD; CACD2; DS; MDBS1; PRPH; rd2; RDS; RP7; TSPAN22
Locus ID 5961
UniProt ID P23942
Cytogenetics 6p21.1
Summary The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein found in the outer segment of both rod and cone photoreceptor cells. It may function as an adhesion molecule involved in stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. This protein is essential for disk morphogenesis. Defects in this gene are associated with both central and peripheral retinal degenerations. Some of the various phenotypically different disorders are autosomal dominant retinitis pigmentosa, progressive macular degeneration, macular dystrophy and retinitis pigmentosa digenic. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Protein Pathways Amyotrophic lateral sclerosis (ALS)
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRPH2" proteins (3)
SKU Description Size Price
LC400122 Lyophilized PRPH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400122 Transient overexpression lysate of peripherin 2 (retinal degeneration, slow) (PRPH2) (as WB positive control) 100 ug
$436.00
TP310357 Recombinant protein of human peripherin 2 (retinal degeneration, slow) (PRPH2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products