OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EIF4EBP3 (NM_003732) Human Mass Spec Standard

Be the first to review this product
SKU
PH310053
EIF4EBP3 MS Standard C13 and N15-labeled recombinant protein (NP_003723)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY418472 Transient overexpression lysate of eukaryotic translation initiation factor 4E binding protein 3 (EIF4EBP3) (as WB positive control) 100 ug
$436.00

Other products for "EIF4EBP3 or NM_003732"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210053
Predicted MW 10.9 kDa
Protein Sequence
Protein Sequence
>RC210053 protein sequence
Red=Cloning site Green=Tags(s)

MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTP
PTAPLSKLEELKEQETEEEIPDDAQFEMDI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003723
RefSeq Size 728
RefSeq ORF 300
Synonyms 4E-BP3; 4EBP3
Locus ID 8637
UniProt ID O60516
Cytogenetics 5q31.3
Summary This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap structure. Read-through transcription from the neighboring upstream gene (MASK or ANKHD1) generates a transcript (MASK-BP3) that encodes a protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. provided by RefSeq, Oct 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EIF4EBP3" proteins (3)
SKU Description Size Price
LC418472 Lyophilized EIF4EBP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418472 Transient overexpression lysate of eukaryotic translation initiation factor 4E binding protein 3 (EIF4EBP3) (as WB positive control) 100 ug
$436.00
TP310053 Recombinant protein of human eukaryotic translation initiation factor 4E binding protein 3 (EIF4EBP3), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products