OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMD4 (NM_002810) Human Mass Spec Standard

Be the first to review this product
SKU
PH310046
PSMD4 MS Standard C13 and N15-labeled recombinant protein (NP_002801)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA330259 Rabbit Polyclonal Anti-PSMD4 Antibody
100 ul
$585.00
LY400997 Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 (PSMD4) (as WB positive control) 100 ug
$436.00

Other products for "PSMD4 or NM_002810"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210046
Predicted MW 40.7 kDa
Protein Sequence
Protein Sequence
>RC210046 protein sequence
Red=Cloning site Green=Tags(s)

MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGR
ILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDI
INFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDP
SADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSS
MTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE
AIRNAMGSLASQATKDGKKDKKEEDKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002801
RefSeq Size 1332
RefSeq ORF 1131
Synonyms AF; AF-1; ASF; MCB1; pUB-R5; Rpn10; S5A
Locus ID 5710
UniProt ID P55036
Cytogenetics 1q21.3
Summary The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. Pseudogenes have been identified on chromosomes 10 and 21. provided by RefSeq, Jul 2008
Protein Pathways Proteasome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PSMD4" proteins (4)
SKU Description Size Price
LC400997 Lyophilized PSMD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400997 Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 (PSMD4) (as WB positive control) 100 ug
$436.00
TP310046 Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 (PSMD4), 20 µg 20 ug
$737.00
TP760263 Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 (PSMD4), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products