OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PPM1F (NM_014634) Human Mass Spec Standard

Be the first to review this product
SKU
PH310043
PPM1F MS Standard C13 and N15-labeled recombinant protein (NP_055449)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351551 Rabbit Polyclonal Anti-PPM1F Antibody
100 ul
$205.00
LY402357 Transient overexpression lysate of protein phosphatase 1F (PP2C domain containing) (PPM1F) (as WB positive control) 100 ug
$436.00

Other products for "PPM1F or NM_014634"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210043
Predicted MW 49.7 kDa
Protein Sequence
Protein Sequence
>RC210043 protein sequence
Red=Cloning site Green=Tags(s)

MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRK
APPPLAAALAHEAVSQLLQTDLSEFRKLPREEEEEEEDDDEEKAPVTLLDAQSLAQSFFNRLWEVAGQWQ
KQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAAV
HVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILVQ
QGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTGS
EDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLE
GGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055449
RefSeq Size 5199
RefSeq ORF 1359
Synonyms CAMKP; CaMKPase; FEM-2; hFEM-2; POPX2
Locus ID 9647
UniProt ID P49593
Cytogenetics 22q11.22
Summary The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PPM1F" proteins (3)
SKU Description Size Price
LC402357 Lyophilized PPM1F HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402357 Transient overexpression lysate of protein phosphatase 1F (PP2C domain containing) (PPM1F) (as WB positive control) 100 ug
$436.00
TP310043 Recombinant protein of human protein phosphatase 1F (PP2C domain containing) (PPM1F), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products