OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CAAP1 (NM_024828) Human Mass Spec Standard

Be the first to review this product
SKU
PH310037
C9orf82 MS Standard C13 and N15-labeled recombinant protein (NP_079104)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA360805 CAAP1 Antibody - middle region
100 ul
$585.00
LY410946 Transient overexpression lysate of chromosome 9 open reading frame 82 (C9orf82), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CAAP1 or NM_024828"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210037
Predicted MW 38.4 kDa
Protein Sequence
Protein Sequence
>RC210037 protein sequence
Red=Cloning site Green=Tags(s)

MTGKKSSREKRRKRSSQEAAAALAAPDIVPALASGSSGSTSGCGSAGGCGSVSCCGNANFSGSVTGGGSG
GSCWGGSSVERSERRKRRSTDSSSVSGSLQQETKYILPTLEKELFLAEHSDLEEGGLDLTVSLKPVSFYI
SDKKEMLQQCFCIIGEKKLQKMLPDVLKNCSIEEIKKLCQEQLELLSEKKILKILEGDNGMDSDMEEEAD
DGSKMGSDLVSQQDICIDSASSVRENKQPEGLELKQGKGEDSDVLSINADAYDSDIEGPCNEEAAAPEAP
ENTVQSEAGQINDLEKDIEKSVNEILGLAESSPNEPKAATLAVPPPEDVQPSAQQLELLELEMRARAIKA
LMKAGDIKKPA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079104
RefSeq Size 2833
RefSeq ORF 1083
Synonyms C9orf82; CAAP
Locus ID 79886
UniProt ID Q9H8G2
Cytogenetics 9p21.2
Summary Anti-apoptotic protein that modulates a caspase-10 dependent mitochondrial caspase-3/9 feedback amplification loop.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CAAP1" proteins (3)
SKU Description Size Price
LC410946 Lyophilized CAAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410946 Transient overexpression lysate of chromosome 9 open reading frame 82 (C9orf82), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310037 Recombinant protein of human chromosome 9 open reading frame 82 (C9orf82), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products