OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LMOD1 (NM_012134) Human Mass Spec Standard

Be the first to review this product
SKU
PH309941
LMOD1 MS Standard C13 and N15-labeled recombinant protein (NP_036266)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334435 Rabbit Polyclonal Anti-LMOD1 Antibody
100 ul
$585.00
LY415960 Transient overexpression lysate of leiomodin 1 (smooth muscle) (LMOD1) (as WB positive control) 100 ug
$436.00

Other products for "LMOD1 or NM_012134"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209941
Predicted MW 66.8 kDa
Protein Sequence
Protein Sequence
>RC209941 representing NM_012134
Red=Cloning site Green=Tags(s)

MSRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLN
FCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDE
AGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREE
MKEVAKKEDDEKVKGERRNTDTRKEGEKMKRAGGNTDMKKEDEKVKRGTGNTDTKKDDEKVKKNEPLHEK
EAKDDSKTKTPEKQTPSGPTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVR
FTEALEFNTVVKLFALANTRADDHVAFAIAIMLKANKTITSLNLDSNHITGKGILAIFRALLQNNTLTEL
RFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKRLQEQRQAQEAKG
EKKDLLEVPKAGAVAKGSPKPSPQPSPKPSPKNSPKKGGAPAAPPPPPPPLAPPLIMENLKNSLSPATQR
KMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036266
RefSeq Size 3967
RefSeq ORF 1800
Synonyms 1D; 64kD; D1; MMIHS3; SM-LMOD; SMLMOD
Locus ID 25802
UniProt ID P29536
Cytogenetics 1q32.1
Summary The leiomodin 1 protein has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LMOD1" proteins (3)
SKU Description Size Price
LC415960 Lyophilized LMOD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415960 Transient overexpression lysate of leiomodin 1 (smooth muscle) (LMOD1) (as WB positive control) 100 ug
$436.00
TP309941 Recombinant protein of human leiomodin 1 (smooth muscle) (LMOD1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products