OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PXMP2 (NM_018663) Human Mass Spec Standard

Be the first to review this product
SKU
PH309935
PXMP2 MS Standard C13 and N15-labeled recombinant protein (NP_061133)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA314412 Rabbit polyclonal anti-PXMP2 antibody
100 ul
$380.00
LY412969 Transient overexpression lysate of peroxisomal membrane protein 2, 22kDa (PXMP2) (as WB positive control) 100 ug
$436.00

Other products for "PXMP2 or NM_018663"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209935
Predicted MW 22.3 kDa
Protein Sequence
Protein Sequence
>RC209935 protein sequence
Red=Cloning site Green=Tags(s)

MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVG
GPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAF
AAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLASLGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061133
RefSeq Size 977
RefSeq ORF 585
Synonyms MPV17L3; PMP22
Locus ID 5827
UniProt ID Q9NR77
Cytogenetics 12q24.33
Summary Seems to be involved in pore-forming activity and may contribute to the unspecific permeability of the peroxisomal membrane.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PXMP2" proteins (3)
SKU Description Size Price
LC412969 Lyophilized PXMP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412969 Transient overexpression lysate of peroxisomal membrane protein 2, 22kDa (PXMP2) (as WB positive control) 100 ug
$436.00
TP309935 Recombinant protein of human peroxisomal membrane protein 2, 22kDa (PXMP2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products