PXMP2 (NM_018663) Human Recombinant Protein

SKU
TP309935
Recombinant protein of human peroxisomal membrane protein 2, 22kDa (PXMP2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209935 protein sequence
Red=Cloning site Green=Tags(s)

MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVG
GPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAF
AAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLASLGK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_061133
Locus ID 5827
UniProt ID Q9NR77
Cytogenetics 12q24.33
RefSeq Size 977
RefSeq ORF 585
Synonyms MPV17L3; PMP22
Summary Seems to be involved in pore-forming activity and may contribute to the unspecific permeability of the peroxisomal membrane.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:PXMP2 (NM_018663) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309935 PXMP2 MS Standard C13 and N15-labeled recombinant protein (NP_061133) 10 ug
$3,255.00
LC412969 PXMP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412969 Transient overexpression lysate of peroxisomal membrane protein 2, 22kDa (PXMP2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.