OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COMMD4 (NM_017828) Human Mass Spec Standard

Be the first to review this product
SKU
PH309638
COMMD4 MS Standard C13 and N15-labeled recombinant protein (NP_060298)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY413513 Transient overexpression lysate of COMM domain containing 4 (COMMD4) (as WB positive control) 100 ug
$436.00

Other products for "COMMD4 or NM_017828"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209638
Predicted MW 21.6 kDa
Protein Sequence
Protein Sequence
>RC209638 representing NM_017828
Red=Cloning site Green=Tags(s)

MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVA
VLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDY
TLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060298
RefSeq Size 1948
RefSeq ORF 597
Locus ID 54939
UniProt ID Q9H0A8
Cytogenetics 15q24.2
Summary May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Down-regulates activation of NF-kappa-B.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COMMD4" proteins (3)
SKU Description Size Price
LC413513 Lyophilized COMMD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413513 Transient overexpression lysate of COMM domain containing 4 (COMMD4) (as WB positive control) 100 ug
$436.00
TP309638 Recombinant protein of human COMM domain containing 4 (COMMD4), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products