DNase II (DNASE2) (NM_001375) Human Mass Spec Standard

CAT#: PH309573

DNASE2 MS Standard C13 and N15-labeled recombinant protein (NP_001366)

Product Images

Coomassie blue staining of purified DNASE2 protein (Cat# TP309573). The protein was produced from HEK293T cells transfected with DNASE2 cDNA clone (Cat# RC209573) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209573
• Predicted MW: 39.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209573 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRALINS
  PEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPAS
  SAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENVVKGHHVSQEP
  WNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFWHKTVGILPSNCSDIWQVLNVNQIA
  FPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGM
  ARKPSRAYKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001366
• RefSeq Size: 2011
• RefSeq ORF: 1080
• Synonyms: DNASE2A; DNL; DNL2
• Locus ID: 1777
• UniProt ID: O00115, A0A024R7F4
• Cytogenetics: 19p13.13
• Summary: This gene encodes a member of the DNase family. The protein, located in the lysosome, hydrolyzes DNA under acidic conditions and mediates the breakdown of DNA during erythropoiesis and apoptosis. Two codominant alleles have been characterized, DNASE2*L (low activity) and DNASE2*H (high activity), that differ at one nucleotide in the promoter region. The DNASE2*H allele is represented in this record. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Lysosome