OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AMSH (STAMBP) (NM_006463) Human Mass Spec Standard

Be the first to review this product
SKU
PH309475
STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_006454)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322496 Anti-STAMBP Rabbit Polyclonal Antibody
100 ul
$305.00
LY403869 Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 3 (as WB positive control) 100 ug
$665.00

Other products for "AMSH or NM_006463"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209475
Predicted MW 48.1 kDa
Protein Sequence
Protein Sequence
>RC209475 protein sequence
Red=Cloning site Green=Tags(s)

MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLF
IEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQ
ELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPT
LTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVE
TCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH
THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI
TDLR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006454
RefSeq Size 6386
RefSeq ORF 1272
Synonyms AMSH; MICCAP
Locus ID 10617
UniProt ID O95630
Cytogenetics 2p13.1
Summary Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AMSH" proteins (11)
SKU Description Size Price
PH301090 STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_964010) 10 ug
$3,360.00
PH317643 STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_998787) 10 ug
$3,360.00
LC403869 Lyophilized STAMBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404497 Lyophilized STAMBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416628 Lyophilized STAMBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403869 Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY404497 Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY416628 Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301090 Recombinant protein of human STAM binding protein (STAMBP), transcript variant 2, 20 µg 20 ug
$737.00
TP309475 Recombinant protein of human STAM binding protein (STAMBP), transcript variant 1, 20 µg 20 ug
$737.00
TP317643 Recombinant protein of human STAM binding protein (STAMBP), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products