AMSH (STAMBP) (NM_201647) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC201090] |
Predicted MW | 48.1 kDa |
Protein Sequence |
Protein Sequence
>RC201090 protein sequence
Red=Cloning site Green=Tags(s) MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLF IEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQ ELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPT LTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVE TCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI TDLR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_964010 |
RefSeq Size | 6277 |
RefSeq ORF | 1272 |
Synonyms | AMSH; MICCAP |
Locus ID | 10617 |
UniProt ID | O95630 |
Cytogenetics | 2p13.1 |
Summary | Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH309475 | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_006454) | 10 ug |
$3,255.00
|
|
PH317643 | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_998787) | 10 ug |
$3,255.00
|
|
LC403869 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC404497 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416628 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403869 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 3 | 100 ug |
$665.00
|
|
LY404497 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 2 | 100 ug |
$436.00
|
|
LY416628 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 1 | 100 ug |
$436.00
|
|
TP301090 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP309475 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP317643 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.