AMSH (STAMBP) (NM_201647) Human Mass Spec Standard

SKU
PH301090
STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_964010)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201090]
Predicted MW 48.1 kDa
Protein Sequence
Protein Sequence
>RC201090 protein sequence
Red=Cloning site Green=Tags(s)

MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLF
IEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQ
ELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPT
LTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVE
TCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH
THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI
TDLR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_964010
RefSeq Size 6277
RefSeq ORF 1272
Synonyms AMSH; MICCAP
Locus ID 10617
UniProt ID O95630
Cytogenetics 2p13.1
Summary Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:AMSH (STAMBP) (NM_201647) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309475 STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_006454) 10 ug
$3,255.00
PH317643 STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_998787) 10 ug
$3,255.00
LC403869 STAMBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404497 STAMBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416628 STAMBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403869 Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 3 100 ug
$665.00
LY404497 Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 2 100 ug
$436.00
LY416628 Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 1 100 ug
$436.00
TP301090 Recombinant protein of human STAM binding protein (STAMBP), transcript variant 2, 20 µg 20 ug
$737.00
TP309475 Recombinant protein of human STAM binding protein (STAMBP), transcript variant 1, 20 µg 20 ug
$737.00
TP317643 Recombinant protein of human STAM binding protein (STAMBP), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.