AMSH (STAMBP) (NM_201647) Human Recombinant Protein

SKU
TP301090
Recombinant protein of human STAM binding protein (STAMBP), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201090 protein sequence
Red=Cloning site Green=Tags(s)

MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLF
IEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQ
ELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPT
LTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVE
TCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH
THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI
TDLR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_964010
Locus ID 10617
UniProt ID O95630
Cytogenetics 2p13.1
RefSeq Size 6277
RefSeq ORF 1272
Synonyms AMSH; MICCAP
Summary Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:AMSH (STAMBP) (NM_201647) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301090 STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_964010) 10 ug
$3,255.00
PH309475 STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_006454) 10 ug
$3,255.00
PH317643 STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_998787) 10 ug
$3,255.00
LC403869 STAMBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404497 STAMBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416628 STAMBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403869 Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 3 100 ug
$665.00
LY404497 Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 2 100 ug
$436.00
LY416628 Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 1 100 ug
$436.00
TP309475 Recombinant protein of human STAM binding protein (STAMBP), transcript variant 1, 20 µg 20 ug
$737.00
TP317643 Recombinant protein of human STAM binding protein (STAMBP), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.