OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ATPBD4 (DPH6) (NM_080650) Human Mass Spec Standard

Be the first to review this product
SKU
PH309471
ATPBD4 MS Standard C13 and N15-labeled recombinant protein (NP_542381)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA359323 DPH6 Antibody - C-terminal region
100 ul
$585.00
LY409120 Transient overexpression lysate of ATP binding domain 4 (ATPBD4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ATPBD4 or NM_080650"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209471
Predicted MW 30.3 kDa
Protein Sequence
Protein Sequence
>RC209471 protein sequence
Red=Cloning site Green=Tags(s)

MRVAALISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLY
RRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSDYQRIRVENVCKRLNLQPLAY
LWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTL
DCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIYNF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542381
RefSeq Size 2139
RefSeq ORF 801
Synonyms ATPBD4
Locus ID 89978
UniProt ID Q7L8W6
Cytogenetics 15q14
Summary Amidase that catalyzes the last step of diphthamide biosynthesis using ammonium and ATP. Diphthamide biosynthesis consists in the conversion of an L-histidine residue in the translation elongation factor (EEF2) to diphthamide (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ATPBD4" proteins (5)
SKU Description Size Price
LC409120 Lyophilized DPH6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427988 Lyophilized DPH6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409120 Transient overexpression lysate of ATP binding domain 4 (ATPBD4), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427988 Transient overexpression lysate of ATP binding domain 4 (ATPBD4), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP309471 Recombinant protein of human ATP binding domain 4 (ATPBD4), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products