OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LAP3 (NM_015907) Human Mass Spec Standard

Be the first to review this product
SKU
PH309052
LAP3 MS Standard C13 and N15-labeled recombinant protein (NP_056991)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345102 Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region
100 ul
$585.00
LY402470 Transient overexpression lysate of leucine aminopeptidase 3 (LAP3) (as WB positive control) 100 ug
$436.00

Other products for "LAP3 or NM_015907"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209052
Predicted MW 56.2 kDa
Protein Sequence
Protein Sequence
>RC209052 protein sequence
Red=Cloning site Green=Tags(s)

MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRET
LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSV
EVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEM
TPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFV
GKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVV
RAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKD
EVPYLRKGMTGRPTRTLIEFLLRFSQDNA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056991
RefSeq Size 2100
RefSeq ORF 1557
Synonyms HEL-S-106; LAP; LAPEP; PEPS
Locus ID 51056
UniProt ID P28838
Cytogenetics 4p15.32
Summary Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Protease
Protein Pathways Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LAP3" proteins (3)
SKU Description Size Price
LC402470 Lyophilized LAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402470 Transient overexpression lysate of leucine aminopeptidase 3 (LAP3) (as WB positive control) 100 ug
$436.00
TP309052 Recombinant protein of human leucine aminopeptidase 3 (LAP3), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products