LAP3 (NM_015907) Human Mass Spec Standard

CAT#: PH309052

LAP3 MS Standard C13 and N15-labeled recombinant protein (NP_056991)

Product Images

Coomassie blue staining of purified LAP3 protein (Cat# TP309052). The protein was produced from HEK293T cells transfected with LAP3 cDNA clone (Cat# RC209052) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209052
• Predicted MW: 56.2 kDa
• Protein Sequence:
  Sequence Link

  >RC209052 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRET
  LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSV
  EVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEM
  TPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFV
  GKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVV
  RAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
  ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKD
  EVPYLRKGMTGRPTRTLIEFLLRFSQDNA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056991
• RefSeq Size: 2100
• RefSeq ORF: 1557
• Synonyms: HEL-S-106; LAP; LAPEP; PEPS
• Locus ID: 51056
• UniProt ID: P28838
• Cytogenetics: 4p15.32
• Summary: Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways