GSTO2 (NM_183239) Human Mass Spec Standard

CAT#: PH308961

GSTO2 MS Standard C13 and N15-labeled recombinant protein (NP_899062)

Product Images

Coomassie blue staining of purified GSTO2 protein (Cat# TP308961). The protein was produced from HEK293T cells transfected with GSTO2 cDNA clone (Cat# RC208961) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208961
• Predicted MW: 28.3 kDa
• Protein Sequence:
  Sequence Link

  >RC208961 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFG
  HIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGREC
  TNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWD
  PTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_899062
• RefSeq Size: 1546
• RefSeq ORF: 729
• Synonyms: bA127L20.1; GSTO 2-2
• Locus ID: 119391
• UniProt ID: Q9H4Y5
• Cytogenetics: 10q25.1
• Summary: The protein encoded by this gene is an omega class glutathione S-transferase (GST). GSTs are involved in the metabolism of xenobiotics and carcinogens. Four transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010]
• Protein Pathways: Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450