GSTO2 (NM_183239) Human Tagged ORF Clone

SKU
RC208961
GSTO2 (Myc-DDK-tagged)-Human glutathione S-transferase omega 2 (GSTO2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GSTO2
Synonyms bA127L20.1; GSTO 2-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208961 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGGGATGCGACCAGGACCCTGGGGAAAGGAAGCCAGCCCCCAGGGCCAGTCCCGGAGGGGCTGA
TCCGCATCTACAGCATGAGGTTCTGCCCCTATTCTCACAGGACCCGCCTCGTCCTCAAGGCCAAAGACAT
CAGACATGAAGTGGTCAACATTAACCTGAGAAACAAGCCTGAATGGTACTATACAAAGCACCCTTTTGGC
CACATTCCTGTCCTGGAGACCAGCCAATGTCAACTGATCTATGAATCTGTTATTGCTTGTGAGTACCTGG
ATGATGCTTATCCAGGAAGGAAGCTGTTTCCATATGACCCTTATGAACGAGCTCGCCAAAAGATGTTATT
GGAGCTATTTTGTAAGGTCCCACATTTGACCAAGGAGTGCCTGGTAGCGTTGAGATGTGGGAGAGAATGC
ACTAATCTGAAGGCAGCCCTGCGTCAGGAATTCAGCAACCTGGAAGAGATTCTTGAGTATCAGAACACCA
CCTTCTTTGGTGGAACCTGTATATCCATGATTGATTACCTCCTCTGGCCCTGGTTTGAGCGGCTGGATGT
GTATGGGATACTGGACTGTGTGAGCCACACGCCAGCCCTGCGGCTCTGGATATCAGCCATGAAGTGGGAC
CCCACAGTCTGTGCTCTTCTCATGGATAAGAGCATTTTCCAGGGCTTCTTGAATCTCTATTTTCAGAACA
ACCCTAATGCCTTTGACTTTGGGCTGTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208961 protein sequence
Red=Cloning site Green=Tags(s)

MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFG
HIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGREC
TNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWD
PTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_183239
ORF Size 729 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_183239.2
RefSeq Size 1546 bp
RefSeq ORF 732 bp
Locus ID 119391
UniProt ID Q9H4Y5
Cytogenetics 10q25.1
Protein Pathways Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450
MW 28.3 kDa
Summary The protein encoded by this gene is an omega class glutathione S-transferase (GST). GSTs are involved in the metabolism of xenobiotics and carcinogens. Four transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010]
Write Your Own Review
You're reviewing:GSTO2 (NM_183239) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208961L3 Lenti ORF clone of Human glutathione S-transferase omega 2 (GSTO2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC208961L4 Lenti ORF clone of Human glutathione S-transferase omega 2 (GSTO2), transcript variant 1, mGFP tagged 10 ug
$600.00
RG208961 GSTO2 (tGFP-tagged) - Human glutathione S-transferase omega 2 (GSTO2), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC307563 GSTO2 (untagged)-Human glutathione S-transferase omega 2 (GSTO2), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.