OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BCDIN3D (NM_181708) Human Mass Spec Standard

Be the first to review this product
SKU
PH308818
BCDIN3D MS Standard C13 and N15-labeled recombinant protein (NP_859059)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA373961 BCDIN3D Rabbit polyclonal Antibody
100 ul
$410.00
LY405655 Transient overexpression lysate of BCDIN3 domain containing (BCDIN3D) (as WB positive control) 100 ug
$436.00

Other products for "BCDIN3D or NM_181708"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208818
Predicted MW 33.2 kDa
Protein Sequence
Protein Sequence
>RC208818 protein sequence
Red=Cloning site Green=Tags(s)

MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILG
LDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQR
TRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRL
RKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEK
GKEKNRLSFQKQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_859059
RefSeq Size 3266
RefSeq ORF 876
Locus ID 144233
UniProt ID Q7Z5W3
Cytogenetics 12q13.12
Summary This gene encodes an RNA methyltransferase which belongs to the rossmann fold methyltransferase family, and serves as a 5'-methylphosphate capping enzyme that is specific for cytoplasmic histidyl tRNA. The encoded protein contains an S-adenosylmethionine binding domain and uses the methyl group donor, S-adenosylmethionine. This gene is overexpressed in breast cancer cells, and is related to the tumorigenic phenotype and poor prognosis of breast cancer. The encoded protein is thought to promote the cellular invasion of breast cancer cells, by downregulating the expression of tumor suppressor miRNAs through the dimethylation of the 5-monophosphate of the corresponding precursor miRNAs. provided by RefSeq, Apr 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BCDIN3D" proteins (3)
SKU Description Size Price
LC405655 Lyophilized BCDIN3D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405655 Transient overexpression lysate of BCDIN3 domain containing (BCDIN3D) (as WB positive control) 100 ug
$436.00
TP308818 Recombinant protein of human BCDIN3 domain containing (BCDIN3D), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products