CGGBP1 (NM_003663) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC208653] |
Predicted MW | 18.8 kDa |
Protein Sequence |
Protein Sequence
>RC208653 protein sequence
Red=Cloning site Green=Tags(s) MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKR KAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI PKSDQLRRAYLPDGYENENQLLNSQDC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_003654 |
RefSeq Size | 4506 |
RefSeq ORF | 501 |
Synonyms | CGGBP; p20-CGGBP |
Locus ID | 8545 |
UniProt ID | Q9UFW8 |
Cytogenetics | 3p11.1 |
Summary | This gene encodes a CGG repeat-binding protein that primarily localizes to the nucleus. CGG trinucleotide repeats are implicated in many disorders as they often act as transcription- and translation-regulatory elements, can produce hairpin structures which cause DNA replication errors, and form regions prone to chromosomal breakage. CGG repeats are also targets for CpG methylation. In addition to its ability to bind CGG repeats and regulate transcription, this gene is believed to play a role in DNA damage repair and telomere protection. In vitro studies indicate this protein does not bind to methylated CpG sequences. [provided by RefSeq, Jul 2017] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH323883 | CGGBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001008391) | 10 ug |
$3,255.00
|
|
LC418512 | CGGBP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423417 | CGGBP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY418512 | Transient overexpression lysate of CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 2 | 100 ug |
$436.00
|
|
LY423417 | Transient overexpression lysate of CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1 | 100 ug |
$436.00
|
|
TP308653 | Recombinant protein of human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323883 | Recombinant protein of human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.