CGGBP1 Rabbit Polyclonal Antibody

SKU TA338345

Rabbit Polyclonal Anti-CGGBP1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CGGBP1 antibody is: synthetic peptide directed towards the N-terminal region of Human CGGBP1. Synthetic peptide located within the following region: GGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 19 kDa
• Gene Name: CGG triplet repeat binding protein 1
• Database Link:
  NP_001008391
  Q9UFW8
• Background: CGGBP1 influences expression of the FMR1 gene, which is associated with the fragile X mental retardation syndrome, by specifically interacting with the 5-prime (CGG)n-3-prime repeat in its 5-prime UTR.
• Synonyms: CGGBP; p20-CGGBP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data