CGGBP1 (NM_001008390) Human Mass Spec Standard

SKU
PH323883
CGGBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001008391)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223883]
Predicted MW 18.8 kDa
Protein Sequence
Protein Sequence
>RC223883 protein sequence
Red=Cloning site Green=Tags(s)

MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKR
KAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI
PKSDQLRRAYLPDGYENENQLLNSQDC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001008391
RefSeq Size 4608
RefSeq ORF 501
Synonyms CGGBP; p20-CGGBP
Locus ID 8545
UniProt ID Q9UFW8
Cytogenetics 3p11.1
Summary This gene encodes a CGG repeat-binding protein that primarily localizes to the nucleus. CGG trinucleotide repeats are implicated in many disorders as they often act as transcription- and translation-regulatory elements, can produce hairpin structures which cause DNA replication errors, and form regions prone to chromosomal breakage. CGG repeats are also targets for CpG methylation. In addition to its ability to bind CGG repeats and regulate transcription, this gene is believed to play a role in DNA damage repair and telomere protection. In vitro studies indicate this protein does not bind to methylated CpG sequences. [provided by RefSeq, Jul 2017]
Write Your Own Review
You're reviewing:CGGBP1 (NM_001008390) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH308653 CGGBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003654) 10 ug
$3,255.00
LC418512 CGGBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423417 CGGBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418512 Transient overexpression lysate of CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 2 100 ug
$436.00
LY423417 Transient overexpression lysate of CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1 100 ug
$436.00
TP308653 Recombinant protein of human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323883 Recombinant protein of human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.