OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OLIG3 (NM_175747) Human Mass Spec Standard

Be the first to review this product
SKU
PH308613
OLIG3 MS Standard C13 and N15-labeled recombinant protein (NP_786923)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345605 Rabbit Polyclonal Anti-OLIG3 Antibody
100 ul
$585.00
LY406237 Transient overexpression lysate of oligodendrocyte transcription factor 3 (OLIG3) (as WB positive control) 100 ug
$436.00

Other products for "OLIG3 or NM_175747"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208613
Predicted MW 29.4 kDa
Protein Sequence
Protein Sequence
>RC208613 protein sequence
Red=Cloning site Green=Tags(s)

MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKY
KIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTSS
LEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIR
PPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_786923
RefSeq Size 2196
RefSeq ORF 816
Synonyms Bhlhb7; bHLHe20
Locus ID 167826
UniProt ID Q7RTU3
Cytogenetics 6q23.3
Summary May determine the distinct specification program of class A neurons in the dorsal part of the spinal cord and suppress specification of class B neurons.UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OLIG3" proteins (3)
SKU Description Size Price
LC406237 Lyophilized OLIG3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406237 Transient overexpression lysate of oligodendrocyte transcription factor 3 (OLIG3) (as WB positive control) 100 ug
$436.00
TP308613 Recombinant protein of human oligodendrocyte transcription factor 3 (OLIG3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products