OLIG3 Rabbit Polyclonal Antibody

SKU TA345605

Rabbit Polyclonal Anti-OLIG3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OLIG3 antibody: synthetic peptide directed towards the N terminal of human OLIG3. Synthetic peptide located within the following region: MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: oligodendrocyte transcription factor 3
• Database Link:
  NP_786923
  Q7RTU3
• Background: OLIG3 may determine the distinct specification program of class A neurons in the dorsal part of the spinal cord and suppress specification of class B neurons.
• Synonyms: Bhlhb7; bHLHe20
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Transcription Factors