CCDC103 (NM_213607) Human Mass Spec Standard

CAT#: PH308345

CCDC103 MS Standard C13 and N15-labeled recombinant protein (NP_998772)

Product Images

Coomassie blue staining of purified CCDC103 protein (Cat# TP308345). The protein was produced from HEK293T cells transfected with CCDC103 cDNA clone (Cat# RC208345) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208345
• Predicted MW: 27.2 kDa
• Protein Sequence:
  Sequence Link

  >RC208345 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERNDIINFKALEKELQAALTADEKYKRENAAKLRAVEQRVASYEEFRGIVLASHLKPLERKDKMGGKRT
  VPWNCHTIQGRTFQDVATEISPEKAPLQPETSADFYRDWRRHLPSGPERYQALLQLGGPRLGCLFQTDVG
  FGLLGELLVALADHVGPADRAAVLGILCSLASTGRFTLNLSLLSRAERESCKGLFQKLQAMGNPRSVKEG
  LSWEEQGLEEQSGGLQEEERLLQELLELYQVD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_998772
• RefSeq Size: 1766
• RefSeq ORF: 726
• Synonyms: CILD17; PR46b; SMH
• Locus ID: 388389
• UniProt ID: Q8IW40
• Cytogenetics: 17q21.31
• Summary: This gene encodes a protein that contains a coiled-coil domain. [provided by RefSeq, Apr 2012]