STIMATE (NM_198563) Human Mass Spec Standard

CAT#: PH308295

TMEM110 MS Standard C13 and N15-labeled recombinant protein (NP_940965)

Product Images

Coomassie blue staining of purified STIMATE protein (Cat# TP308295). The protein was produced from HEK293T cells transfected with STIMATE cDNA clone (Cat# RC208295) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208295
• Predicted MW: 33.2 kDa
• Protein Sequence:
  Sequence Link

  >RC208295 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFSTLMLKRFREPKHERRPWRIW
  FLDTSKQAIGMLFIHFANVYLADLTEEDPCSLYLINFLLDATVGMLLIYVGVRAVSVLVEWQQWESLRFG
  EYGDPLQCGAWVGQCALYIVIMIFEKSVVFIVLLILQWKKVALLNPIENPDLKLAIVMLIVPFFVNALMF
  WVVDNFLMRKGKTKAKLEERGANQDSRNGSKVRYRRAASHEESESEILISADDEMEESDVEEDLRRLTPL
  KPVKKKKHRFGLPV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_940965
• RefSeq Size: 4746
• RefSeq ORF: 882
• Synonyms: TMEM110
• Locus ID: 375346
• UniProt ID: Q86TL2
• Cytogenetics: 3p21.1
• Summary: Acts as a regulator of store-operated Ca(2+) entry (SOCE) at junctional sites that connect the endoplasmic reticulum (ER) and plasma membrane (PM), called ER-plasma membrane (ER-PM) junction or cortical ER (PubMed:26322679, PubMed:26644574). SOCE is a Ca(2+) influx following depletion of intracellular Ca(2+) stores (PubMed:26322679). Acts by interacting with STIM1, promoting STIM1 conformational switch (PubMed:26322679). Involved in STIM1 relocalization to ER-PM junctions (PubMed:26644574). Contributes to the maintenance and reorganization of store-dependent ER-PM junctions (PubMed:26644574).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane